Abbreviation
Recombinant Human DLL3 protein, partial (Active)
Purity
Greater than 85% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized DLL3 at 2 μg/mL can bind Anti-DLL3 Recombinant Antibody（CSB-RA882142A1HU）, the EC50 is 1.102-1.707 ng/mL.
Research Area
Cell Biology
Alternative Names
(Drosophila Delta homolog 3)(Delta3)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
27-492aa
Target Protein Sequence
AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized DLL3 at 2 μg/ml can bind Anti-DLL3 Recombinant Antibody（CSB-RA882142A1HU）, the EC50 is 1.102-1.707 ng/mL.
Description
DLL3 is an atypical Notch ligand that functions as a cis-inhibitor of Notch signaling, making it a high-value target in antibody development programs for neuroendocrine tumors. This recombinant human DLL3 partial construct (aa 27–492) is expressed in mammalian cells with a C-terminal 6xHis tag, preserving native-like glycosylation critical for accurate binding studies. Functional ELISA validation demonstrates that immobilized DLL3 at 2 μg/mL binds anti-DLL3 recombinant antibody with an EC50 of 1.102–1.707 ng/mL, confirming robust receptor-ligand interaction suitable for antibody screening, epitope binning, and SPR-based affinity measurements. With purity exceeding 85% by SDS-PAGE and endotoxin levels below 1.0 EU/μg by LAL testing, this preparation meets the quality thresholds commonly required for functional cell-based Notch signaling assays and serves as a reliable positive control in immunoassay development workflows.
