Abbreviation
Recombinant Human IL6 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 58 - 295 pg/mL.
Alternative Names
Interleukin-6; IL-6; B-cell stimulatory factor 2 (BSF-2); CTL differentiation factor (CDF); Hybridoma growth factor; Interferon beta-2 (IFN-beta-2); IL6 ; IFNB2
Species
Homo sapiens (Human)
Expression Region
30-212aa
Target Protein Sequence
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of human TF-1 cells is 58 - 295 pg/mL.
-
IL6 (Siltuximab) Recombinant Monoclonal Antibody (CSB-RA011664MA1HU) captured on Protein A Chip can bind Recombinant Human IL-6 protein with an affinity constant of 0.135 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
IL-6 orchestrates acute-phase responses and drives the transition from innate to adaptive immunity, making it a central node in inflammation and oncogenesis research. This recombinant protein, spanning the full mature sequence (aa 30–212) and expressed in yeast with an N-terminal 6xHis tag, demonstrates dose-dependent proliferative activity in human TF-1 cells with an ED50 of 58–295 pg/mL, confirming receptor engagement at physiologically relevant concentrations and supporting its use in cell-based proliferation assays with primary T cells, B cells, and PBMCs. The low endotoxin level (< 1.0 EU/μg) is critical for preventing LPS-induced artifacts in immune cell activation studies, particularly when dissecting JAK/STAT3 and NF-κB signaling pathways or evaluating cytokine-driven differentiation. Purity exceeding 95% by SDS-PAGE, combined with validated bioactivity, provides a suitable basis for antibody development workflows, including immunogen preparation and ELISA standard curve generation in cytokine detection platforms.
