Abbreviation
Recombinant Human IL3 protein (Active)
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.4476-1.272 ng/mL.
Alternative Names
IL-3;Hematopoietic growth factor;Mast cell growth factor;MCGF;Multipotential colony-stimulating factor;P-cell-stimulating factor
Species
Homo sapiens (Human)
Expression Region
20-152aa
Target Protein Sequence
APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 0.4476-1.272 ng/mL.
Description
Interleukin-3 drives the proliferation and differentiation of multipotent hematopoietic progenitors and mast cells, making it a critical tool for dissecting lineage commitment and cytokine-dependent survival pathways in primary human cells. This recombinant protein, spanning the full mature sequence (aa 20–152), demonstrates robust bioactivity with an ED50 of 0.4476–1.272 ng/mL in TF-1 cell proliferation assays, providing a quantitative benchmark for dose-response studies in cell-based functional screens and JAK/STAT signaling pathway investigations. The endotoxin level of less than 1.0 EU/μg eliminates LPS-driven artifacts that confound immune cell activation experiments, supporting its use in primary PBMC differentiation assays and in vivo inflammation models where cytokine-specific effects must be isolated from innate immune noise. Purity exceeding 90% by SDS-PAGE, combined with the validated proliferative potency, aligns with standards expected in antibody development workflows, including immunogen preparation and ELISA standard curve generation.
