Home
Product
Protein
Active Protein
Growth Factor
Recombinant Human Fibroblast growth factor 8 (FGF8) (Active)

Recombinant Human Fibroblast growth factor 8 (FGF8) (Active)

In Stock

Code: CSB-AP004031HU

Rate （N/A）
Review （0）

Size:

10ug50ug500ug1mg

US$204

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: Tag-Free

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Human FGF8 protein (Active)

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 0.01 EU/µg as determined by LAL method.

Activity

The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 21.87 ng/ml.

Uniprot NO.

P55075-3

Research Area

Cancer

Alternative Names

AIGF; Androgen induced growth factor; Androgen-induced growth factor; FGF 8; FGF-8; FGF-8b; FGF8; FGF8_HUMAN; Fibroblast growth factor 8 (androgen induced); Fibroblast growth factor 8; Fibroblast growth factor 8 precursor; HBGF 8; HBGF-8; HBGF8; Heparin-binding growth factor 8; HH6; KAL6

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

23-215aa

Target Protein Sequence

QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

22.5 kDa

Protein Length

Full Length of Mature Protein of Isoform FGF-8B

Tag Info

Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered 20mM PB,300mM NaCl,2% Sucrose,0.02% Tween 80,pH7.4.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

FGF8 isoform B plays a critical role in embryonic patterning, limb development, and tumor progression, making it a key target in both developmental biology and cancer research. This tag-free recombinant human FGF8 spans residues 23–215, covering the full mature sequence of isoform FGF-8B, and demonstrates an ED50 of 21.87 ng/mL in BALB/c 3T3 cell proliferation assays—confirming robust mitogenic potency suitable for cell proliferation studies, angiogenesis models, and in vivo tumor biology experiments. The E. coli expression system produces a non-glycosylated protein that provides a consistent, defined baseline for receptor-ligand binding assays via SPR or ELISA, as well as for neuronal or osteogenic differentiation protocols where glycosylation-independent signaling is under investigation. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typically required for sensitive cell-based assays and antibody characterization workflows.