FIL1; FIL1 zeta; FIL1(ZETA); FIL1Z; IL 1 zeta; IL 1F7; IL 1F7b (IL 1H4; IL 1H; IL 1RP1) ; IL 1H4; IL 1RP1; IL 1X; IL 1X protein; IL-1 zeta; IL-1F7; IL-1H; IL-1H4; IL-1RP1; IL-1X; IL-37; IL1F7 (canonical product IL 1F7b) ; IL1F7; IL1F7_HUMAN; IL1H4; IL1RP1; Interleukin 1 family member 7; interleukin 1 family; member 7 (zeta); Interleukin 1 homolog 4; Interleukin 1 related protein; Interleukin 1 superfamily z; Interleukin 1 zeta; Interleukin 37; Interleukin-1 family member 7; Interleukin-1 homolog 4; Interleukin-1 zeta; Interleukin-1-related protein; Interleukin-23
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
53-218aa
Target Protein Sequence
KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.7 kDa
Protein Length
Partial
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 2 mM DTT, pH 7.4
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.
Gene References into Functions
a genome wide association study for "high" gingival crevicular fluid IL-1beta expression among 4910 European-American adults and identify association signals in the IL37 locus, is reported.PMID:30206230
IL-37 can be secreted extracellularly, and binds to IL-18Ra chain and recruits Toll/IL-1R (TIR)-8 for transducing anti-inflammatory signaling. IL-37 is upregulated in an inducible manner and negatively regulates signaling mediated by TLR agonists and pro-inflammatory cytokines.PMID:28548248
Our results showed that IL-37 plays an inhibitory role in non-small cell lung cancer progression, possibly by suppressing STAT3 activation and decreasing epithelial-to-mesenchymal transition by inhibiting IL-6 expression. IL-37 could serve as a potential novel tumor suppressor in non-small cell lung cancerPMID:29575809
TIM-3 and IL-37 may be used as potential biomarkers of active rheumatoid arthritis.PMID:30106887
This study suggests that human IL-37 overexpressed in mice reduces lean body mass by reducing food intake.PMID:30072596
These data suggest that IL37 is a new susceptibility gene for Coronary artery disease (CAD), which provides a potential target for the prevention and treatment of CADPMID:28181534
In allergic rhinits patients, the IL-1R8 ligand IL-37 could potentially modulate aberrant immune responses by attenuating IL-17 and IL-4 production by CD4+ T cells.PMID:29730558
Review of role of interleukin 37 in physiology and disease.PMID:29805973
this study shows that Interleukin-37 alleviates airway inflammation and remodeling in asthma via inhibiting the activation of NF-kappaB and STAT3 signalingsPMID:29268192
IL1F7 gene polymorphism does not significantly influence rheumatoid arthritis susceptibility in the Northern Chinese Han population.PMID:29336365
IL37 may be an important cytokine in the pathogenesis of allergic rhinitis.PMID:29115624
results suggest that there was a low level of interleukin 37 in the eutopic and ectopic endometria of patients with adenomyosisPMID:28762845
Study concludes that recombinant human interleukin-37 enhances the suppressive activity of CD4(+)CD25(+) regulatory T cells and might be a potential immunomodulator for the treatment of septic complications.PMID:27941849
IL-37 level is elevated in systemic lupus erythematous patients in comparison to healthy controls and is correlated to high disease activity, mucocutaneous and renal involvement.PMID:28627005
An association of IL-37 single nucleotide polymorphism rs3811047 with Behcet's disease, but not Vogt-Koyanagi-Harada disease in Han Chinese.PMID:27775096
The data suggest that IL-10, but not IL-37, may have potential as a biomarker predictive for disease activity in Systemic lupus erythematosus.PMID:27708376
this study shows that IL-37 causes excessive inflammation and tissue damage in murine pneumococcal pneumoniaPMID:28601872
common genetic variants of IL37 lead to different immune-inhibitory potencies.PMID:27665946
IL-37 increased from normal control (NC) to oral leukoplakia (OLK) and oral squamous cell carcinoma (OSCC). IL-37 expression was lower in OSCC with lymph node metastasis than those without metastasis. IL-37 overexpression in RAW264.7 cells remarkably reduced the pseudopodia, vacuolization and the expression of IL-6, TNF-alpha, and IL-1beta. IL-37 and IL-18Ralpha but not IL-18BP have similar expression and location in ...PMID:27225603
We conclude that under low-grade inflammatory conditions, hematopoietic IL-37 expression reduces the inflammatory state, but does not influence atherosclerosis development in hyperlipidemic LDLr-deficient mice.PMID:28792474
The IL- 37 (rs3811047) polymorphism contributes to the development of ADs in a Chinese population.PMID:29642198
IL-37 is produced primarily by CD4+ T cells and vascular smooth muscle cells and that it plays a protective role in atherosclerotic injury by directing a switch in CD4+ T lymphocyte phenotypes in addition to directly regulating the expression of caspase-3 to reduce H2O2- and pro-inflammatoryinduced SMC apoptosis.PMID:29439249
Blocking IL-1 with IL-37 alleviates the symptoms in patients with inflammatory diseases including arteriosclerosis. The impact of IL-37 on inflammatory cytokines mediating atherosclerosis is beneficial and protective.PMID:28420489
these data highlight the importance of IL-37 in the cell proliferation and progression of hepatocellular carcinomaPMID:27835881
Serum Il-37 level is significantly increased in acute coronary syndrome. IL-37 may exert a cardioprotective effect by suppressing ROCK activity.PMID:28039466
this study found that IL-37 levels in peritoneal fluid and in serum were significantly higher in patients with endometriosis compared to women without endometriosisPMID:28322860
IL-37 profile in patients with acute coronary syndrome and the increased IL-37 concentration was associated with a worse clinical in-hospital outcome in STEMI patients undergoing PPCIPMID:28237549
this study shows that human IL-37 inhibited LPS-induced mouse osteoclast formation and bone resorption via inhibition of LPS-induced osteoclast related cytokinesPMID:27154248
serum IL-37 and its mRNA expression is increased in Ankylosing spondylitis (AS) patients with special consideration in patient with Osteoporosis and correlates with disease activity and BMD which indicate that IL-37 may provide a novel research target for pathogenesis and therapy of AS.PMID:28502149
this study shows that macrophage-specific expression of IL-37 in hyperlipidemic mice attenuates atherosclerosisPMID:29030487
IL-27 and IL-37 limit the induction of particular T cell subsets along with cytokine responses in S. stercoralis infections, which suggest the importance of IL-27 and IL-37 in immune modulation in a chronic helminth infection.PMID:28874444
constitutive IL-37 secretion by myeloid dendritic cells may serve to maintain an anti-inflammatory milieu at steady state, whereas IL-37 is stored in monocytes to be available for rapid release upon inflammatory encounters.PMID:27881605
IL-37 regulates autophagy in SMMC-7721 and Huh-7 cells via inhibition of the PI3K/AKT/mTOR signaling pathway.PMID:28433890
IL-37 inhibited the proliferation of hepatocellular carcinoma SMMC-7721 cells.PMID:28395710
these findings reveal that intracellular IL-37b is a critical factor in the negative regulation of multiple signaling pathways that modulate the expression of metastasis-related genesPMID:28092676
IL-37 may be employed as a new molecular target for the therapy and diagnosis of Tuberculosis.PMID:28076390
IL37 itself reduced IL1beta, IL6 and IL8 production in osteoarthritis chondrocytes, indicating that IL37 is able to induce a counter-regulatory anti-inflammatory feedback loop in chondrocytes. In addition, IL37 dampens catabolic enzyme expression.PMID:27940589
IL-37 is elevated in AF patients and its expression is closely associated with AF subgroups. Thus, IL-37 may provide a novel research target for the pathogenesis and therapy of AF.PMID:28244597
These results indicate that a decreased IL-37 expression by colon epithelial cells may be an important factor for increasing the recruitment of immune cells and subsequently developing microscopic colitis.PMID:28044228
reviewed the updated evidence indicating the roles of IL-35 and IL-37 in asthmaPMID:27878686
serum level of IL-37 plays a part in the pathophysiology of multiple myeloma progression.PMID:27807338
this study shows that IL-37 could decrease both NF-kappaB and ICAM-1 expression upon TLR2 activation in human coronary artery endothelial cells, and that this effect may be due to its inhibition on NF-kappaBPMID:27233003
Results show that elevated plasma IL-37 level and its associations with anti-Sm, anti-RNP and C3 in systemic lupus erythematosus patients suggest that IL-37 may be implicated in this disease.PMID:27125292
the present data suggest that rs2723176 SNP of IL-37 is involved in the development of TB infection.PMID:27761939
this study reviews the role of IL-37 as a key suppressor of asthma mediated by mast cellsPMID:27982737
In the discovery phase, two nonsynonymous SNPs (rs3811046 and rs3811047), located in the IL1F7 gene and in an intergenic region, respectively were found to be weakly associated with non-high tension glaucoma cases.PMID:27533638
CCL22 and IL-37 with a co-localization in the A549 cells inhibited the proliferationPMID:27499437
increased IL-37 concentrations are associated with the onset of arterial calcificationPMID:27451144
These findings suggest that increased expression of IL-37 was present in eutopic and ectopic endometrium of women with ovarian endometriosis, which might be involved in the inflammatory process of endometriomas.PMID:26342048
These fi ndings suggest that elevation of HLA-G and IL-37 in hepatitis C virus may play an important role in response to combined therapy with interferon-apha and ribovirin.PMID:27112970
Show
More
Hide
All
Subcellular Location
Cytoplasm, cytosol. Nucleus. Secreted.
Protein Families
IL-1 family
Tissue Specificity
In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis,