Abbreviation
Recombinant Human IL15RA protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL15RA at 2 μg/mL can bind Human IL15(CSB-MP011593HU).The EC50 is 32.53-38.41 ng/mL.
Alternative Names
IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA
Species
Homo sapiens (Human)
Expression Region
31-205aa
Target Protein Sequence
ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL15RA at 2 μg/ml can bind Human IL15(CSB-MP011593HU).The EC50 is 32.53-38.41 ng/mL.
-
The purity of IL15RA was greater than 95% as determined by SEC-HPLC
Description
IL-15 receptor alpha plays a central role in trans-presentation of IL-15 to effector lymphocytes, making it a critical node in NK cell and CD8+ T cell homeostasis. This mammalian-expressed construct spanning residues 31–205 captures the complete sushi domain responsible for high-affinity IL-15 binding, and functional ELISA validation demonstrates specific interaction with human IL-15 at an EC50 of 32.53–38.41 ng/mL, providing quantitative evidence of preserved ligand recognition. The confirmed binding activity supports use in competitive inhibition assays for therapeutic antibody screening, receptor-ligand interaction studies by surface plasmon resonance or biolayer interferometry, and epitope mapping of biologics targeting the IL-15/IL-15RA axis. Endotoxin levels below 1.0 EU/μg and purity exceeding 95% meet the quality thresholds commonly required for cell-based assays and in vitro pharmacology studies where contamination could confound immune cell responses.
