Abbreviation
Recombinant Human RSPO1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human RSPO1 at 2 μg/mL can bind Human LGR5(CSB-MP012906HU1), the EC50 is 124.0-174.1 ng/mL.
Alternative Names
(Roof plate-specific spondin-1) (hRspo1)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
31-263aa
Target Protein Sequence
RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-Avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human RSPO1 at 2 μg/ml can bind Human LGR5(CSB-MP012906HU1), the EC50 is 124.0-174.1 ng/mL.
Description
R-spondin-1 is a critical potentiator of Wnt/β-catenin signaling that drives stem cell self-renewal and tissue homeostasis, making validated receptor-binding activity essential for meaningful experimental results. This recombinant human RSPO1 (aa 31–263) demonstrates confirmed binding to its cognate receptor LGR5 with an EC₅₀ of 124.0–174.1 ng/mL in functional ELISA, providing a suitable basis for receptor-ligand binding and competition assays, as well as serving as a reliable ELISA standard for antibody characterization studies. Mammalian cell expression preserves native glycosylation patterns important for proper folding and receptor engagement, supporting use in intestinal organoid culture, stem cell self-renewal assays, and Wnt pathway-dependent proliferation studies. The C-terminal 10×His-Avi tag facilitates oriented immobilization for SPR-based kinetic measurements, while purity exceeding 95% and endotoxin levels below 1.0 EU/μg satisfy the criteria typically required for cell-based differentiation assays and in vivo regenerative biology models.
