Abbreviation
Recombinant Human RBP4 protein (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/ml can bind TTR (CSB-MP025270HUh6), the EC50 is 695.0-970.1 ng/ml.
Alternative Names
(Plasma retinol-binding protein)(PRBP)(RBP)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
19-201aa
Target Protein Sequence
ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized RBP4 at 5 μg/ml can bind TTR (CSB-MP025270HUh6), the EC50 is 695.0-970.1 ng/ml.
-
The purity of RBP4 was greater than 90% as determined by SEC-HPLC.
Description
RBP4 serves as the principal carrier of retinol in circulation, and its interaction with transthyretin (TTR) stabilizes the complex to prevent renal filtration—making validated binding activity essential for meaningful in vitro studies. This recombinant human RBP4 (aa 19–201, full-length mature protein) demonstrates confirmed TTR-binding capacity with an EC50 of 695.0–970.1 ng/ml in functional ELISA, providing a suitable basis for ligand-binding assays, cargo-release studies, and structural or biophysical characterization of the RBP4–TTR axis. The C-terminal hFc1 tag facilitates oriented immobilization, supporting use as an ELISA standard or in antibody development campaigns targeting RBP4 in cancer-related research contexts. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for drug-protein binding studies and membrane transporter functional assays where both conformational integrity and low background interference are critical.
