Abbreviation
Recombinant Human TMEFF2 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody (CSB-RA883439MA1HU), the EC50 is 2.129-2.956 ng/mL.
Alternative Names
(TR-2)(Hyperplastic polyposis protein 1)(Transmembrane protein with EGF-like and two follistatin-like domains)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
41-320aa
Target Protein Sequence
FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody (CSB-RA883439MA1HU), the EC50 is 2.129-2.956 ng/mL.
Description
TMEFF2 plays a multifaceted role in prostate cancer biology and neuronal survival signaling, making it a valuable target for both tumor biology studies and antibody development campaigns. This recombinant human TMEFF2 partial construct, spanning residues 41–320 with a C-terminal 10×His tag, is produced in mammalian cells to preserve native-like glycosylation critical for proper folding of its EGF-like and follistatin-like domains. Functional ELISA validation demonstrates strong binding to an anti-TMEFF2 recombinant antibody with an EC₅₀ of 2.129–2.956 ng/mL, confirming that this protein is appropriate for receptor-ligand binding assays, antibody characterization, and use as a reliable ELISA standard. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based proliferation and survival assays as well as in vivo tumor biology models requiring stringent endotoxin control.