Recombinant Dog Tumor necrosis factor (TNF)

Product Details

Purity
>85% (SDS-PAGE)
Target Names
TNF
Uniprot NO.
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Source
Yeast
Expression Region
57-233
Target Protein Sequence
GPQREELPNGLQLISPLAQTVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANG VELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSP CQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Extracellular domain
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.
Gene References into Functions
  1. two SNPs of the TNF gene are associated with obesity in Labrador dogs PMID:26692319
  2. Fatal outcome from pulmonary hemorrhages in dogs with leptospirosis was associated with low TNF-alpha, high IL-1beta, and high iNOS expression. PMID:26824356
  3. This diminished TNF-alpha, IL-6 and iNOS expression, and NO production was in parallel to the respective decreased NF-kappaB p65 protein nuclear translocation in the LPS-activated canine PBMCs pretreated with 25 microM and 50 microM propofol. PMID:25312048
  4. Tumour necrosis factor (TNF)-alpha expression was observed in vascular endothelial cells in both neoplastic and normal kidney. PMID:22300704
  5. The observed HMGB1 release kinetics showed a clearly time-dependent manner with a peak release 24h after TNF-alpha stimulation, while stimulation with IFN-gamma had only small effects on the HMGB1 release. PMID:22154216
  6. the TNF-alpha-induced activation of the ERK/GEF-H1/RhoA pathway in tubular cells is mediated through Src- and TACE-dependent EGFR activation. PMID:21212278
  7. The replication characteristics of H3N8 influenza virus and its effects on protein expression of canine alveolar macrophages are reported; only TNF-alpha levels were significantly increased 12 h after inoculation. PMID:19605916
  8. Inflammatory cytokines and NO may be involved in intraneural inflammatory changes arising from mechanical compression PMID:16022989
  9. mRNA and protein structures and identities of the present known mammalian TNFA. PMID:17573384
  10. findings suggest that susceptibility to Anal furunculosis in German Shepherd dogs is primarily associated with DLA-DRB1*00101 and any association with the Tumor Necrosis Factor-alpha locus is secondary and is because of linkage disequilibrium . PMID:19254251
  11. the ERK/GEF-H1/Rho/Rho kinase/phospho-MLC pathway is the mechanism mediating TNF-alpha-induced elevation of tubular epithelial permeability, which in turn might contribute to kidney injury PMID:19261619
  12. The usefulness of HSP27, HSP70, and TNF-alpha as biological markers for canine skin diseases was studied. PMID:19578946

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, soluble form]: Secreted.; [C-domain 1]: Secreted.; [C-domain 2]: Secreted.
Protein Families
Tumor necrosis factor family
Database Links

UNIGENE: Cfa.54

KEGG: cfa:403922

STRING: 9615.ENSCAFP00000000739

  Email: support@cusabio.com
  Distributors Worldwide

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1