Very nice to receive your inquiry.
Expression Region: 4088-4199aa; Partial.
Tag information: Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:
ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG
If you are interested in AA 1-238 of ANK3, we can provide this region, please check the details as follows:
Recombinant Human Ankyrin-3(ANK3),partial
CSB-YP619642HU1 >> Yeast
CSB-EP619642HU1 >> E.coli
CSB-BP619642HU1 >> Baculovirus
CSB-MP619642HU1 >> Mammalian cell
Expression Region: 1-238aa; Partial.
Tag information: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is list as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:
MAHAASQLKKNRDLEINAEEEPEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTP
Since you mentioned that you prefer the tag removed protein, but you could only remove the GST-tag in your own lab,
The tag type of all these proteins will be determined during the manufacturing process, we recommend to choose the tag removed protein, as we are not sure if the protein will be GST-tagged.
Please remark your requirement for tag removal if you need the untagged protein or tag removal when placing the order.
Sorry, we haven't tried to remove the tag before. We can try enzyme digestion, but we can't guarantee 100% successfully.
The overall success rate of enzyme digestion data analysis is 75%-86%.
* Not all protein tags can be removed as some proteins will be very unstable after tag removal.
* If we succeed in removing the tag, we will charge for extra cost.
* If we fail in removing the tag, we won’t charge for tag removal and provide the fusion protein, and remark this information in datasheet as follows
“Note: The laboratory determined that the Tag on your protein could not be removed with standard laboratory procedures. Your protein is being supplied with the Tag intact.”
* Generally, the delivery time will be extended for 3 days.