Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Interleukin-1 beta convertase ;IL-1BCInterleukin-1 beta-converting enzyme ;ICE ;IL-1 beta-converting enzymep45
Species
Homo sapiens (Human)
Expression Region
120-269aa
Target Protein Sequence
NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description
Amino acids 120-269 form the expressed segment for recombinant Human CASP1. The theoretical molecular weight of the CASP1 protein is 43.8 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of CASP1, making it easier to detect and purify the CASP1 recombinant protein in the later stages of expression and purification.
Caspase-1 (CASP1) is a crucial enzyme primarily involved in the regulation of inflammation and apoptosis. One of its key research areas is its role in immune system inflammation regulation. CASP1 is a critical component of the inflammasome, triggering inflammatory responses by activating pro-inflammatory cytokines IL-1β and IL-18, contributing to infection defense and maintaining immune balance. CASP1 is also a subject of interest in the study of inflammatory diseases, showing close associations with autoimmune diseases, neuroinflammation, and the inflammatory processes related to tumors. Researchers aim to uncover the precise regulatory mechanisms of CASP1 in the development of these diseases, hoping to develop relevant therapeutic strategies. Additionally, CASP1 plays a crucial role in the regulation of apoptosis, being involved in the activation of the non-canonical apoptosis pathway, which is essential for maintaining the normal physiological balance of tissues and organs.
