Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Glandular kallikrein-1;Tissue kallikrein-2
Species
Homo sapiens (Human)
Expression Region
19-261aa
Target Protein Sequence
PLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Kallikrein-2 plays a critical role in prostate physiology and serves as a biomarker in prostate cancer diagnostics, yet functional studies require enzyme preparations that retain native catalytic properties. This full-length recombinant protein (aa 19–261) demonstrates robust proteolytic activity with a specific activity exceeding 350 pmol/min/µg against the fluorogenic substrate Pro-Phe-Arg-7-amido-4-methylcoumarin, providing a quantitative foundation for kinetic parameter analysis including Km, Vmax, and kcat/kcat/Km determination. The C-terminal His tag preserves active site accessibility while enabling straightforward purification, and binding to an anti-KLK2 antibody with an EC50 of 0.67–0.82 ng/mL confirms proper folding and epitope presentation for use as a positive control in immunoassays. Purity greater than 90% by SDS-PAGE and endotoxin levels below 1.0 EU/µg satisfy the quality thresholds commonly required for inhibitor screening, IC50 determination, and substrate specificity profiling where contaminant proteases would compromise data interpretation.
