AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.4kD
Protein Length
Extracellular domain
Tag Info
N-terminal His-tagged/Tag-Free The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
in acute myeloid leukemia patients the association of CD7 positivity and FLT3 positivity was found to be significantPMID:25679063
Data show that CD7 promotes extramedullary involvement of the B-ALL line Tanoue in an integrin beta2-dependent manner.PMID:24920488
We showed that the CADM1 versus CD7 plot is capable of discriminating clonally expanding HTLV-I-infected cells in indolent and acute-type T-cell leukemia-lymphomas and in asymptomatic carriersPMID:24727323
CD7 is present on monocytes and tumor macrophages and its ligand, SECTM1, is frequently expressed in corresponding melanoma tissuesPMID:24157461
SECTM1 secreted from bone marrow stromal cells may interact with CD7 to influence GM-CSF expression in leukemic cells.PMID:24211252
epigenetic down-regulation of CD7 is associated with acute myeloid leukemia.PMID:20398252
CD7 loss in aggressive natural killer-cell leukemia; a useful diagnostic markerPMID:20046078
low expression in T-cell lymphomas due to Twist2-mediated suppression of promoter activity; enhanced by histone deacetylase inhibitorsPMID:19937140
These findings indicate a link between epigenetic modifications and CD7 expression in primitive chronic myeloid leukemia cells.PMID:20175919
CD7 expression in hematopoitic cells denotes commitment to B-cell and natural killer cells lineages.PMID:12393702
Association of T cell antigen CD7 with type II phosphatidylinositol-4 kinase, a key component in pathways of inositol phosphate turnover.PMID:12594831
a novel fusion protein, designated scFvCD7:sFasL is designed to have leukemia-restricted activity.PMID:16332967
Patients expressing CD7 had significant shorter disease free (DFS) and post-remission survivals (PRS) than patients without CD7 (DFS of 12 months versus 42 months, P=0.005; PRS of 15 months versus 33 months, P=0.013).PMID:16837044
CD7 antigen notably expresses in lung microvascular endothelial cells (LME) and that it acts as an Fc receptor for IgM in LME cells.PMID:16990185
HTLV-IInfected cells acquired a profound decrease of intracellular calcium levels in response to ionomycin, timely correlated with decreased CD7 expressionPMID:17287851
differential levels of CD7 identify the progressive stages of lineage commitment in human thymus, initiated from a primitive CD7(-) lympho-myeloid thymic progenitorPMID:17959857
close association of aberrant CD7 expression and FLT3/ITD mutation in the myeloblasts of FLT3/ITD+ acute myeloid leukemia suggests that FLT3/ITD- mediated leukemic transformation occurs in the more early stage of myeloid progenitor cellsPMID:18343790
The CD7 expression in CD4(+) T cells discriminates between HL and reactive LAD, suggesting that this could be a useful and practical adjunctive tool in the diagnosis of Hodgkin lymphoma.PMID:18956470
by down-regulating CD7, ATLL cells could have escaped Gal-3-induced apoptosis to run a more aggressive clinical coursePMID:19207946
the galectin-1 glycoprotein receptor CD7 maybe a novel target for GdA on T cells.PMID:19683346