Home
Product
Protein
Recombinant Proteins
Recombinant Human Talin-2 (TLN2), partial, partial

Recombinant Human Talin-2 (TLN2), partial, partial

Mammalian cell

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

TLN2

Uniprot NO.

Q9Y4G6

Research Area

Signal Transduction

Species

Homo sapiens (Human)

Source

Baculovirus

Expression Region

88-406aa

Target Protein Sequence

RPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

53.1kD

Protein Length

Partial

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

As a major component of focal adhesion plaques that links integrin to the actin cytoskeleton, may play an important role in cell adhesion. Recruits PIP5K1C to focal adhesion plaques and strongly activates its kinase activity.

Gene References into Functions

The central role of talin and vinculin in cell adhesions suggests that the disintegration of the tissue in atherosclerosis could be partially driven by downregulation of these genes, leading to loosening of cell-ECM interactions and remodeling of the tissue. PMID:27816808
These results suggest that a strong interaction of talin2 with integrins is required to generate traction, which in turn drives invadopodium-mediated matrix degradation, which is key to cancer cell invasion. PMID:27694340
data suggest a potential molecular link between TLN2 and camptodactyly pathogenesis. PMID:27223613
Both TLN-1 and TLN-2 levels correlate with tumorigenicity in human HCC, indicating that these molecules constitute important molecular targets for the diagnosis and/or treatment of hepatocellular carcinoma . PMID:26822056
Data indicate the role of vinculin in inducing the talin mediated integrin activation. PMID:24446374
Talin1 has unique expression versus talin 2 in the heart and modifies the hypertrophic response to pressure overload. PMID:23266827
Data show that SCGB3A1 was down-regulated in invasive compared with DCIS, whereas talin 2 (TLN2) and PTGS1 were up-regulated in invasive compared with DCIS. PMID:21812955
This review discusses the general function of talin 1 and talin 2, as well as vinculin/metavinulin, with emphasis on what is understood about their role in the cardiac myocyte and in whole heart. PMID:19952892
Structural diversity in integrin/talin interactions. PMID:21134644
the differential concentration of CSF and serum-talin 2 in the drug-refractory postencephalitic epilepsy group is an intractability-related phenomenon that might be involved in the development of RPEE PMID:20620133
we show that the predominant brain splice variant of PtdInsPKI gamma (PtdInsPKI gamma-90) binds, by means of a short carboxy-terminal peptide, to the FERM domain of talin, and is strongly activated by this interaction PMID:12422219
The F-actin binding capacity of Talin 2 is regulated by intrasteric occlusion of primary actin-binding determinants within the talin I/LWEQ module. PMID:15581353
Talin2 may serve as the link between integrins and the sarcomeric cytoskeletonin stable adhesion complexes in mature striated muscle. PMID:17183545
Data show that TLN2n presents only in the CSF of temporal lobe epilepsy patients. PMID:19109932

Hide All

Subcellular Location

Cytoplasm. Cell junction, focal adhesion. Cell junction, synapse. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton.

Database Links

HGNC: 15447

UNIGENE: Hs.569438

KEGG: hsa:83660

STRING: 9606.ENSP00000303476

OMIM: 607349

Promotions