Purity
Greater than 85% as determined by SDS-PAGE.
Species
Macaca mulatta (Rhesus macaque)
Expression Region
19-178aa
Target Protein Sequence
SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description
This Recombinant Macaca mulatta IL10 protein was made through genetic engineering. By putting the IL10 gene into the genetic material of Mammalian cell cell, the Mammalian cell could be used as factories or producers to make the desired IL10 protein for research uses. The expression region of this protein is at 19-178aa. C-terminal 10xHis tag was used in the expression process. The purity is 85%+ determined by SDS-PAGE.
IL-10 is the founding member of a family of cytokines. The involvement of IL-10 in many disease states has been demonstrated, both in animal models and in humans with mutations in the IL-10/IL-10R axis. IL-10 was discovered 30 yr ago as a secreted cytokine synthesis inhibitory factor, produced by T helper (Th) 2 cell clones shown to inhibit cytokine production by Th1 cells. IL10–mediated inhibition of IFN-γ secretion by Th1 cells was demonstrated to occur via its action on the APC function of macrophages and by its inhibition of cytokine production by activated macrophages and dendritic cells. Additionally, IL-10 inhibited the killing of intracellular pathogens. The role of IL-10 clearly exceeds the regulation of intestinal inflammation, as a function for this molecule has been also described in several other settings, from inflammatory or neurodegenerative diseases to infection or cancer. In summary, IL-10 has emerged as a major suppressor of the immune response and a key player in human disease, and is thus an attractive therapeutic target.
