Recombinant Mouse Apelin receptor (Aplnr), partial

Code: CSB-EP001910MO1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$388
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Aplnr
Uniprot NO.
Research Area
Cardiovascular
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
307-377aa
Target Protein Sequence
YAFFDPRFRQACTSMLCCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQETLVD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.1 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
13-23 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for apelin receptor early endogenous ligand (APELA) and apelin (APLN) hormones coupled to G proteins that inhibit adenylate cyclase activity. Plays a key role in early development such as gastrulation, blood vessels formation and heart morphogenesis by acting as a receptor for APELA hormone. May promote angioblast migration toward the embryonic midline, i.e. the position of the future vessel formation, during vasculogenesis. Promotes sinus venosus (SV)-derived endothelial cells migration into the developing heart to promote coronary blood vessel development. Plays also a role in various processes in adults such as regulation of blood vessel formation, blood pressure, heart contractility and heart failure.
Gene References into Functions
  1. the expression of APLNR (APJ/AGTRL1), the only known receptor for apelin, is predominantly restricted to the endothelial cells. PMID:28904225
  2. The ELA-APJ axis protects from pressure overload-induced heart failure possibly via suppression of ACE expression and pathogenic angiotensin II signaling. PMID:28371822
  3. Internalization does not appear to contribute to the desensitization of APJ-mediated ppERK1/2 activation. PMID:27492965
  4. the ELABELA (ELA)-APJ signaling axis is only required for sinus venosus-derived progenitors. PMID:28890073
  5. These results demonstrate a new pharmacologic property of protamine-blockade of APJ-that could explain some adverse effects observed in protamine-treated patients, and that the established antiangiogenic activity of protamine would rely on APJ antagonism. PMID:28242772
  6. Apelin-36-[L28C(30kDa-PEG)] provides a starting point for the development of diabetes therapeutics that are devoid of the blood pressure effects associated with canonical APJ activation PMID:27994053
  7. Results show that obese mice had significantly lower mRNA and protein expressions of apelin/ APJ in skeletal muscles than the normal body weight mice. PMID:27834140
  8. These results demonstrate that overexpression of APJ in cardiomyocytes has adverse effects on cardiac function in male and non-pregnant mice and that lactation contributes to the development of postpartum cardiomyopathy in the heart with APJ overexpression. PMID:27033703
  9. Endothelial CXCR4 is negatively regulated by miR-139-5p, whose transcription is in turn induced by laminar flow and APLN/APLNR signalling. PMID:27068353
  10. apelin is produced by arterial endothelial cells (ECs) during embryogenesis, induces chemotaxis of venous ECs, and promotes the production of secreted Frizzled-related protein 1 by apelin receptor(+) ECs PMID:25920569
  11. Findings demonstrate a stimulatory role for the islet cell apelin-APJ signaling axis in regulation of pancreatic islet homeostasis and in metabolic induced beta-cell hyperplasia. PMID:25965959
  12. ERG and APLNR are essential for endothelial homeostasis in venules in the lung and that perturbation in ERG-APLNR signaling is crucial for the development of pulmonary veno-occlusive disease. PMID:25062690
  13. These findings suggest that apelin-APJ signaling is a potential therapeutic target in the treatment of vasculogenic erectile dysfunction. PMID:23578329
  14. regulates the Nodal/Bone Morphogenetic Protein antagonist Cerberus and the Baf60c/Smarcd3 subunit of the Brg1/Brm-associated factors (BAF) chromatin-remodelling complex PMID:23787002
  15. In obese and insulin-resistant mice, plasma apelin concentration after fasting was not modified but, the gene-expression level of the APL/APJ system was augmented in the white adipose tissue and reduced in the brown adipose tissue, liver and in kidneys. PMID:23747606
  16. These findings imply that the pancreatic apelin-APJ system functions to curb the inflammatory and fibrosis responses during pancreatitis, and that apelin reduces inflammation and fibrosis by reducing neutrophil recruitment and PSC activity. PMID:23681476
  17. More than half of the expected Apj-/- embryos died in utero because of cardiovascular developmental defects. Apelin-APJ signaling plays a novel role as a potent regulator of endothelial MEF2 function in the developing cardiovascular system. PMID:23603510
  18. Apelin-APJ signalling may promote Fas-induced liver injury at least partially via JNK activation. PMID:23121371
  19. Centrally administered apelin-13 elicited depression-like behavior in mice, which was mediated via APJ receptor and kappa-opioid receptor, but not CRF receptor. PMID:22728209
  20. We conclude that apelin functions as a new and potent chemoattractant for circulating cKit+/Flk1+/Aplnr+ cells during early myocardial repair, providing myocardial protection against ischemic damage by improving neovascularization via paracine action. PMID:22753078
  21. study found activation of ATreceptors stimulates apelin secretion in Ca(2), protein kinase C and MAPK kinase dependent ways; activation of AT receptors inhibits apelin secretion through cAMP and cGMP dependent pathways; expression of apelin receptor is si PMID:22249006
  22. data indicate that APJ is a bifunctional receptor for both mechanical stretch and the endogenous peptide apelin; by sensing the balance between these stimuli, APJ occupies a pivotal point linking sustained overload to cardiomyocyte hypertrophy PMID:22810587
  23. the novel peptide apelin and its receptor APJ can induce the morphological and functional maturation of blood vessels in tumors PMID:22037214
  24. Apelin receptor mRNA and apelin-13 binding site distribution in mouse tissues PMID:22197493
  25. endothelial cells promote the maturation of astrocytes through the apelin/APJ system in mice PMID:22357924
  26. Disruption of apelin-APJ signaling can exacerbate pulmonary hypertension mediated by decreased activation of AMP-activated kinase and eNOS. PMID:21233449
  27. Apelin receptor expression by smooth muscle cells provides a paracrine pathway in injured vessels that allows endothelial-derived apelin to stimulate their division and migration into the neointima. PMID:20176814
  28. Role for the apelinergic system in mechanisms controlling fluid homeostasis, particularly at a neuroendocrine level. PMID:20136689
  29. data support a role for the apelin-APJ system in the regulation of smooth muscle, epithelial and goblet cell function in the GI tract PMID:19660504
  30. Expression of the murine msr/apj receptor and its ligand apelin is upregulated during formation of the retinal vessels. PMID:11744380
  31. APJ exerts the hypotensive effect in vivo and plays a counterregulatory role against the pressor action of angiotensin II PMID:15087458
  32. Data show that the apj receptor is expressed in pancreatic islets and that apelin-36 inhibits glucose-stimulated insulin secretion both in vivo and in vitro. PMID:15970338
  33. APJ/apelin-meidated molecular mechanisms for cell migration were reported. PMID:16211245
  34. APJ is unlikely to be a gene causing idiopathic dilated cardiomyopathy, but the independent correlation between the 212A allele and a better prognosis suggests that it might act as a modifier gene. PMID:17826642
  35. The apelin-APJ system is a mediator of oxidative stress in vascular tissue, and thus we propose it to be a critical factor in atherogenesis under high-cholesterol dietary conditions. PMID:17884970
  36. Involved in the regulation of blood vessel diameter during angiogenesis. PMID:18200044
  37. apelin/APJ signaling pathways play a critical role in the development of the functional vascular network in adipose tissue. PMID:18708591
  38. physiological role for APJ in mechanisms of water intake and fluid retention suggests an anti-diuretic effect of apelin in vivo PMID:19578099
  39. Results demonstrate that endogenous apelin-APJ signaling plays a modest role in maintaining basal cardiac function in adult mice with a more substantive role during conditions of stress. PMID:19767528

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in coronary endothelial cells (at protein level). Expressed in the embryo, allantoic and endothelial precursor cells of the yolk sac at 8 days post-coitum (dpc). Expressed in the secondary heart field and somite at 8.25 dpc. Expressed in fetal a
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products