Recombinant Mouse Nucleolin (Ncl), partial

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

Ncl

Uniprot NO.

P09405

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

301-646aa

Target Protein Sequence

EGSEPTTPFNLFIGNLNPNKSVNELKFAISELFAKNDLAVVDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLAKNLSFNITEDELKEVFEDAMEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQNPHGKPKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRLELQGSNSRSQPSKTLFVKGLSEDTTEETLKESFEGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Partial

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Nucleolin is the major nucleolar protein of growing eukaryotic cells. It is found associated with intranucleolar chromatin and pre-ribosomal particles. It induces chromatin decondensation by binding to histone H1. It is thought to play a role in pre-rRNA transcription and ribosome assembly. May play a role in the process of transcriptional elongation. Binds RNA oligonucleotides with 5'-UUAGGG-3' repeats more tightly than the telomeric single-stranded DNA 5'-TTAGGG-3' repeats.

Gene References into Functions

The results demonstrated prolific RSV infection of N2a cells, which triggered a decrease of NeuN protein expression, coinciding with an increase of nuclear lesions, F protein expression, RSV viral titers, and late apoptotic levels of N2a cells. RSV infection induced co-localization of RSV F protein with TLR4 and nucleolin. PMID:29427996
The study demonstrated existence of a regulatory axis of miR-34b/nucleolin during muscle differentiation. PMID:28422320
Mitochondrial catalase induces neoplastic cell transformation through nucleolin-dependent Cox-2 mRNA stabilization. PMID:29097213
subcellular sequestration of nucleolin or importin beta1 enhances axonal growth and causes a subcellular shift in protein synthesis PMID:27477284
Data indicate alpha-P85 Subunit, PI-3K (p85alpha) as a positive regulator of epidermal growth factor receptor (EGFR) expression and cell malignant transformation via nucleolin-dependent mechanism. PMID:26918608
nucleolin inhibition is a new anti-pancreatic cancer therapeutic strategy that dually blocks tumor progression and normalizes tumor vasculature in pancreatic ductal adenocarcinoma PMID:27754848
Nucleolin protects macrophages from oxLDL-induced foam cell formation in hyperlipidemia through up-regulating ABCA1 expression. PMID:28315324
Nucleolin Acts as a Scavenger Receptor for Acetylated Low-Density Lipoprotein on Macrophages PMID:26328500
Nucleolin is a receptor for maleylated-bovine serum albumin on macrophages PMID:25744467
Lrrc34, a novel nucleolar protein, interacts with npm1 and ncl and has an impact on pluripotent stem cells PMID:24991885
results indicate that nucleolin is a receptor that allows macrophages to recognize toxic Advanced glycosylation end-products. PMID:24818254
results for the first time demonstrate that nucleolin-SUMO at K294R plays a critical role in its nucleus sequestration and gadd45alpha mRNA binding activity. PMID:25561743
Nucleolin-FGF1 interaction is critical for the intranuclear phosphorylation of FGF1 by PKCdelta and thereby the regulation of nuclear export of FGF1. PMID:24595027
Suggest that during heart disease nucleolin is reactivated to mobilize conserved aspects of chromatin remodeling and gene expression. PMID:24077883
Nucleolin is involved in the regulation of ischemia reperfusion-induced cardiac injury and dysfunction via the regulation of Hsp32. PMID:23594402
Data demonstrate that nucleolin is a critical regulator of ESC self-renewal and that suppression of the p53-dependent pathway is the major molecular mechanism underlying functions of nucleolin in ESCs. PMID:22013067
nucleolin is constantly induced in tumor cells to mediate calcium-dependent ligand internalization PMID:21203423
Nucleolin is clearly involved in the carcinogenic process of H. pylori as a major cellular receptor of Tip-alpha protein that shuttles Tip-alpha from cell surface to cytosol and nuclei. PMID:20049476
nucleolin is one of several acharan sulfate (AS)-binding proteins, and suggest that AS might demonstrate its tumor growth inhibitory activity by binding the nucleolin receptor protein on the surface of cancer cells PMID:15329357
These findings demonstrate the importance of increased translation of p53 in DNA-damage responses and suggest critical roles for RPL26 and nucleolin in affecting p53 induction. PMID:16213212
nucleolin could be involved in the early stage of tooth germ initiation and morphogenesis, possibly by regulating the midkine expression PMID:17562718
analyzed 4.5S RNAh-binding proteins(nucleolin) in mouse nuclear extracts using gel mobility shift and RNA-protein UV cross-linking assays. PMID:17971306