LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.9kD
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Prolactin acts primarily on the mammary gland by promoting lactation.
Gene References into Functions
Prolactin and, to a lesser extent progesterone, which increase in early pregnancy, enhance basal and glucose-stimulated insulin secretion in part by increasing glucokinase activity and amplifying cAMP levels.PMID:14559722
iv infusion of prolactin primarily caused coronary, mesenteric, renal, and iliac vasoconstrictionPMID:17463060
despite a lack of clear relationship between PRL/C499T polymorphism in 5' UTR of the PRL gene and plasma prolactin cioncentration, gene polymorphism impact on reproductiove performance cannot be excludedPMID:19675522