Abbreviation
Recombinant Rat Tnf protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 7.716-15.52 pg/mL.
Alternative Names
Tumor necrosis factor; Cachectin; TNF-alpha; Tumor necrosis factor ligand superfamily member 2 (TNF-a); Tumor necrosis factor, membrane form Alternative names: N-terminal fragment (NTF); Intracellular domain 1 (ICD1); Intracellular domain 2 (ICD2); C-domain 1; C-domain 2; Tumor necrosis factor, soluble form; Tnf; Tnfa, Tnfsf2
Species
Rattus norvegicus (Rat)
Expression Region
80-235aa
Target Protein Sequence
LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured in a cytotoxicity assay using L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 7.716-15.52 pg/mL.
Description
TNF-α drives apoptosis, inflammation, and immune cell activation through TNFR1 and TNFR2 signaling, making precise control of its bioactivity essential for mechanistic studies in cancer and inflammatory disease models. This mammalian-expressed rat TNF (aa 80–235) demonstrates potent cytotoxic activity with an ED50 of 7.7–15.5 pg/mL in L-929 fibroblast assays and binds human TNFRSF1A with an EC50 of 6.2–7.5 ng/mL and a KD of 0.139 nM, confirming receptor engagement at physiologically relevant concentrations suitable for NF-κB and MAPK pathway activation studies, apoptosis assays in tumor cell lines, and in vivo inflammation models. The endotoxin level below 1.0 EU/μg prevents LPS-driven artifacts that confound interpretation in macrophage, dendritic cell, and primary immune cell experiments where TNF and TLR4 pathways converge. Purity exceeding 95% supports its use as a coating antigen in ELISA development and as a reference standard in cytokine detection platforms.
