Recombinant Mouse CD151 antigen (Cd151)

Code: CSB-CF004880MO
Size:
20μg
20μg100μg
US$4388
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Cd151
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-253
Target Protein Sequence
MGEFNEKKATCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASSTYLAT AYILVVAGVVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYVYYQQLNT ELKENLKDTMVKRYHQSGHEGVSSAVDKLQQEFHCCGSNNSQDWQDSEWIRSGEADSRVV PDSCCKTMVAGCGKRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIF TCCLYRSLKLEHY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Essential for the proper assembly of the glomerular and tubular basement membranes in kidney.
Gene References into Functions
  1. in complex with P2Y12 receptor contributes to thrombus growth and stability PMID:26245294
  2. Tetraspanin CD151 Is a Negative Regulator of FcepsilonRI-Mediated Mast Cell Activation PMID:26136426
  3. Integrin-associated CD151 represses mammary branching morphogenesis by controlling progenitor cell activities, extracellular matrix integrity and transcription program. PMID:25486358
  4. Study provide additional evidence that CD151 acts to enhance tumor formation initiated by a range of oncogenes. PMID:25012362
  5. We identify CD151 as a critical factor in tetradecanoylphorbol acetate-dependent skin carcinogenesis. PMID:23792458
  6. Loss of CD151 is associated with drug sensitivity in skin squamous cell carcinoma. PMID:22824799
  7. study provides strong evidence that CD151 collaborates with LB integrins (particularly alpha6beta4 and ErbB2 (and EGFR) receptors to regulate multiple signaling pathways, thereby driving mammary tumor onset, survival, and metastasis PMID:22952421
  8. CD151 importantly modulates podocyte function. PMID:22338088
  9. establish CD151 as a crucial modifier of integrin-mediated adhesion of podocytes to the GBM and show that blood pressure is an important factor in the initiation and progression of Cd151 knockout-induced nephropathy PMID:22201679
  10. CD151 maintains vascular stability by promoting endothelial cell adhesions, especially cell-cell adhesion, and confining cytoskeletal tension. PMID:21832275
  11. diminished metastasis in CD151-null host animals may be due to impaired tumor-endothelial interactions, with underlying defects in mouse lung endothelial cell extracellular matrix production. PMID:21536858
  12. CD151 controls Met-dependent neoplastic growth by enhancing receptor signaling through beta4 integrin-mediated pathways, independent of cell-substrate adhesion PMID:20937830
  13. CD151 may be involved in the interaction of platelets with the subendothelial matrix at sites of vascular damage [review] PMID:12456024
  14. CD151 plays a key role in selectively strengthening alpha6beta1 integrin-mediated adhesion to laminin-1 PMID:12805567
  15. CD151-null mice show phenotypes in several different tissue types: a minor abnormality in hemostasis; keratinocytes migrate poorly in skin explant cultures; T lymphocytes are hyperproliferative in response to in vitro mitogenic stimulation. PMID:15199151
  16. CD151 is essential for normal platelet function and that disruption of CD151 induced a moderate outside-in integrin alpha(IIb)beta(3) signaling defect PMID:15226180
  17. CD151 plays a key role in strengthening alpha3beta1-mediated adhesion in podocytes. PMID:17015618
  18. CD151 modulates molecular organization of laminin-binding integrins, thereby supporting secondary (ie, after cell adhesion) functions of endothelial cells, which are needed for some types of pathologic angiogenesis PMID:17023588
  19. Demonstrate that promoting immobility through a CD151-specific metastasis blocking mAb prevents tumor cell dissemination by inhibiting intravasation without affecting primary tumor growth, tumor cell arrest, extravasation, or growth at the secondary site. PMID:18328426
  20. Data implicate CD151 as a facilitator of laminin-332-mediated keratinocyte functions that impact on the re-epithelialisation process intrinsic to wound healing and further suggest a potential novel role for CD151 in fibroblast migration. PMID:18534576
  21. CD151 is a key regulator of MT1-MMP in endothelial homeostasis PMID:18663148
  22. CD151 appears to be involved in the establishment, maturation, and/or maintenance of the glomerular basement membrane structure in addition to its role in integrin-mediated adhesion strengthening. PMID:18787104
  23. CD37 and CD151 control DC-mediated T-cell activation by two different mechanisms: CD151 regulates co-stimulation whereas CD37 regulates peptide/MHC presentation PMID:19089816

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Tetraspanin (TM4SF) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products