Recombinant Mouse D (4) dopamine receptor (Drd4)

Code: CSB-CF007181MO
Size:
20μg
20μg100μg
US$5390
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Drd4
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-387
Target Protein Sequence
MGNSSATEDGGLLAGRGPESLGTGAGLGGAGAAALVGGVLLIGLVLAGNSLVCVSVASER TLQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASI FNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVASPVVCGLNDVPGRDPAVC CLENRDYVVYSSVCSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPV SDPTQGPFFPDCPPPLPSLRTSPSDSSRPESELSQRPCSPGCLLADAALPQPPEPSSRRR RGAKITGRERKAMRVLPVVVGAFLVCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVN SALNPIIYTIFNAEFRSVFRKTLRLRC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Dopamine receptor responsible for neuronal signaling in the mesolimbic system of the brain, an area of the brain that regulates emotion and complex behavior. Activated by dopamine, but also by epinephrine and norepinephrine, and by numerous synthetic agonists and drugs. Agonist binding triggers signaling via G proteins that inhibit adenylyl cyclase. Modulates the circadian rhythm of contrast sensitivity by regulating the rhythmic expression of NPAS2 in the retinal ganglion cells.
Gene References into Functions
  1. data imply that enhanced D4 receptor-mediated dopaminergic control of corticostriatal transmission constitutes a vulnerability factor of ADHD and other neuropsychiatric disorders. PMID:28097219
  2. Results indicate that the full rescue of impaired LTP in aging is achieved by the selective D4R activation. PMID:28975698
  3. over-suppression of NMDAR function may underlie the role of hD4.7 in attention deficit hyperactivity disorder PMID:27475724
  4. The G-protein coupled receptor, DRD4, requires ARR1 and ARR4 for desensitization and internalization. PMID:26169958
  5. This study demonstrated that dopamine D4 receptor gene has an important role in increased exploratory and anxiolytic behavior only in males and these behaviors were positively correlated with increased alcohol consumption. PMID:25914336
  6. Contrast sensitivity is reduced in Drd4-/- mice. PMID:24048828
  7. dopaminergic modulation of early long-term potentiation in stratum oriens occurs through NMDA receptors containing NR2B subunits via D4Rs PMID:21955919
  8. Data demonstrate that stimulating the dopamine Dreceptor is essential in maintaining the normal rhythmic production of adenylyl cyclase 1 from transcript to enzyme activity. PMID:21676039
  9. This study demonistrated that the dopamine D4 receptor is the role of attention. PMID:21458500
  10. The result of this study demonistrated that the dopamine drd4 receptor appears to be important for specific exploration. PMID:21412225
  11. Data suggest that dopamine D4 receptors modulate not only the prefrontal cortex, but also the cerebellar vermis, which may reflect an indirect modulation as D4Rs are minimally expressed in this region. PMID:20646063
  12. no connection between analysed polymorphism of genes: DRD2, DRD3, DRD4, DAT, COMT and schizophrenia was stated. PMID:20672519
  13. This result suggests an effect of 5-HTTLPR on externalizing behavior in the presence of DRD4 7r but no effect in its absence. PMID:19696961
  14. absence of D4Rs increases avoidance behaviour to unconditioned stimuli and does not impair behavioural reactions to Pavlovian fear-conditioning PMID:11860516
  15. Postsynaptic activation of dopamine D4 receptors reduces GABAergic currents in globus pallidus neurons. PMID:14684868
  16. D4R signaling is essential for the expression of juvenile hyperactivity and impaired behavioral inhibition, relevant features present in this attention deficit disorder-like mouse model. PMID:14699433
  17. The findings suggest that D1, D4, and NMDA receptors may interact functionally and that developmental absence of D4 receptors might trigger compensatory mechanisms that enhance expression of D1 receptors PMID:14997010
  18. D4 dopamine receptor is found to be expressed in the subcommissural organ (SCO), an ependymal brain gland that is located in the roof of the third ventricle. PMID:15197646
  19. Absence of dopamine D4 receptor increases blood pressure, possibly via increased angiotensin II type 1 receptor expression. PMID:16380537
  20. Dopamine D4 receptor knockout mice exhibit neurochemical changes consistent with decreased dopamine release. PMID:17449106
  21. KLHL12 specifically interacts with the D4 polymorphism, thereby building up a Cul3-E3 ligase complex with substrate specificity toward the D4 receptor PMID:18303015
  22. absence of D4R is not sufficient to cause psychopathologies associated with heightened impulsivity and novelty seeking PMID:18456309
  23. data indicate that the DRD4 receptor is involved in modulation of glutamate neurotransmission, primarily in the striatum PMID:18536704
  24. Drd4 activation is required for normal expression of adenylyl cyclase type 1 and for regulation of its catalytic activity by light. PMID:19166506
  25. D(4) dopamine receptor differentially regulates Akt/nuclear factor-kappaB and extracellular signal-regulated kinase pathways in D(4)MN9D cells. PMID:11562449

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in olfactory bulb, hypothalamus, olfactory tubercle, brainstem and striatum.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products