QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTD QNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPN EKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLVLTVIVVVGAILLIPG EKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLALVGLCLCI MACEPVHGPLLISGLGIIALAELLGLVYMKFVASNQRTIQPPRNR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
Gene References into Functions
this study shows that inhibition of IAP represses inflammatory status via nuclear factor-kappa B pathway in murine endometriosis lesionsPMID:29105884
Our results support an intrinsic role of CD47 in ovarian cancer progression and immune evasionPMID:28380460
mice deficient in CD47 (CD47 Knockout) had significantly less brain neutrophil infiltration at 24h, upregulated VEGF expression in peri-lesion cortex at 7 and 14dayPMID:27931776
TSP1 significantly accelerates replicative senescence and associated cell cycle arrest in a CD47-dependent manner.PMID:27607583
CD47, TSP1, and to a lesser extent SIRPalpha facilitate exosome-mediated myeloid-derived suppressor cells chemotaxis and migration.PMID:27728760
In pulmonary hypertension TSP1-CD47 is upregulated, and contributes to pulmonary arterial vasculopathy and dysfunction.PMID:27742621
thrombospondin-1 via CD47 inhibits renal tubular epithelial cell recovery after ischemia reperfusion injury through inhibition of proliferation/self-renewal.PMID:27259369
these findings have demonstrated how tumor cells inhibit innate sensing in dendritic cells and suggested that the CD47-SIRPalpha axis is critical for dendritic cell-driven antitumor immunityPMID:28801234
this study shows that CD47 deficiency in tumor stroma promotes tumor progression by enhancing angiogenesisPMID:27283989
the results obtained by combining bioinformatics and preclinical studies strongly suggest that targeting TSP-1/CD47 axis may represent a valuable therapeutic alternative for hampering melanoma spreading.PMID:27349907
Treg cells protect dopaminergic neurons against MPP+ neurotoxicity by a cell-to-cell contact mechanism underlying CD47-SIRPA interaction and Rac1/Akt activation.PMID:28268219
CD47 deficient mice with vaccination showed greater protective efficacy against lethal challenge.PMID:27194758
These results indicate an important role for CD47-SIRPalpha interactions in innate control of malaria and suggest novel targets for intervention.PMID:27091932
atherogenesis is associated with upregulation of CD47, a key anti-phagocytic molecule that is known to render malignant cells resistant to programmed cell removal, or 'efferocytosis'PMID:27437576
Erythrocyte CD47 has a key role in hematoma clearance after intracerebral hemorrhage.PMID:26732568
These data indicate that CD47 plays protective roles against disseminated candidiasis and alters pro-inflammatory and immunosuppressive pathways known to regulate innate and T cell immunity.PMID:26010544
CD47 deficiency ameliorates lupus nephritis in Fas(lpr) mice via suppression of IgG autoantibody production.PMID:26095930
the cell adhesion molecule CD47 participates in multiple phases of granule cell development, including proliferation, migration, and neurite differentiationPMID:25288019
CD47 mediates signaling from the extracellular matrix that coordinately regulates basal metabolism and cytoprotective responses to radiation injuryPMID:26311851
Taken together, these data revealed a novel role for CD47 in the development of obesity and its related metabolic complications.PMID:25747123
Loss of cell surface CD47 clustering formation and binding avidity to SIRPalpha facilitate apoptotic cell clearance by macrophages.PMID:26085683
findings prove that the TSP-1/CD47/SIRP-alpha signal axis is important to the evolution of tumor cells in the microenvironment of immunotherapy and identify thrombospondin-1 as a key signalPMID:25697354
Thrombospondin-1 and CD47 signaling regulate healing of thermal injury in mice.PMID:24840925
the microglial proinflammatory response to Abeta(1-42) protofibril is not dependent on CD47PMID:25451248
CD47 expression in the microenvironment was sufficient to limit tumor radiosensitivity.PMID:25297630
role in promoting left ventricular heart failure by CaKMII-mediated up-regulation of HDAC3PMID:24922625
Polymorphism in the innate immune receptor SIRPalpha controls CD47 binding and autoimmunity in the nonobese diabetic mouse.PMID:25305319
using a syngeneic mouse hepatocyte transplantation model, the present study demonstrates that missing CD47 on donor cells alone can cause recipient myeloid cell activation and graft loss.PMID:23394628
sought to investigate the effect of Hsp70-peptide complex on the expression of CD172alpha and CD47 receptors in normal peritoneal macrophages (NMO)PMID:24684700
CD47 plays the pivotal role in the immune evasion of primary effusion lymphoma cells in body cavities. Therapeutic antibody targeting of CD47 could be an effective therapy for PEL.PMID:24726056
'clustering' SIRPalpha into plasma membrane microdomains is essential for activated monocytes and macrophages to effectively interact with CD47 and initiate intracellular signalingPMID:24143245
Thrombospondin-1 signaling through CD47 is the first identified endogenous inhibitor of H2S signaling and constitutes a novel mechanism that negatively regulates T cell activation.PMID:23499828
Data indicate that lack of CD47 strongly impairs SIRPalpha-dependent osteoblast differentiation, deteriorate bone formation, and cause reduced formation of osteoclasts.PMID:23990469
Thus, CD47 antagonists enable cell self-renewal and reprogramming by overcoming negative regulation of c-Myc and other stem cell transcription factors.PMID:23591719
CD47 deficiency confers cell survival through the activation of autophagic flux and identifies CD47 blockade as a pharmacological route to modulate autophagy for protecting tissue from radiation injury.PMID:22874555
Inhibitor of apoptosis proteins (IAPs) and their antagonists regulate spontaneous and tumor necrosis factor (TNF)-induced proinflammatory cytokine and chemokine productionPMID:23275336
Although polymorphonuclear neutrophil (PMN) transmigration is not delayed in CD47-deficient mice, fewer neutrophils are found in the intestine at the postacute/chronic stage of chronic colitis.PMID:23203922
CD47(low) status on CD4 effectors is necessary for the contraction/resolution of the immune response in humans and mice.PMID:22870271
Thrombospondin-1 regulates blood flow via CD47 receptor-mediated activation of NADPH oxidase 1.PMID:23087362
ectopic expression of murine Cd47 in human hepatocytes selectively favors engraftment upon transplantation into mice, a finding that should have a profound impact on the generation of robust humanized small animal models.PMID:22535707
Activation of parenchymal CD47 promotes renal ischemia-reperfusion injury.PMID:22859854
Engagement of endothelial CD47 by its ligands triggers outside-in signals in endothelium, facilitating leukocyte transendothelial migration at sites of inflammation.PMID:22815286
Data show that CD47(-/-) mice are refractory to experimental autoimmune encephalomyelitis (EAE).PMID:22734047
Activated CD47 promotes pulmonary arterial hypertension through targeting caveolin-1.PMID:22215724
CD47(high) status on CD4 T cells identifies functional long-lived memory T cell progenitors.PMID:22461697
CD47 signalling is dispensable for oral tolerance induction, whereas the expression of CD47 by non-haematopoietic cells is required for intestinal IgA B-cell responses.PMID:22070457
provides a rational basis for targeting CD47-SIRPalpha interactions, using for instance the antagonistic antibodies against human SIRPalpha described herein, to potentiate the clinical effects of cancer therapeutic antibodiesPMID:22042861
CD47 deletion improves functional recovery from spinal cord injury via an increase in vascular patency, functional locomotor improvements and greater white matter sparing.PMID:21168495