Recombinant Mouse Leukocyte surface antigen CD47 (Cd47)

Code: CSB-CF713985MO
Size:
20μg
20μg100μg
US$4627
Quantity:
Express system: in vitro E.coli expression system
Species: Mus musculus (Mouse)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Cd47
Uniprot NO.
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
19-303
Target Protein Sequence
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTD QNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPN EKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLVLTVIVVVGAILLIPG EKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLALVGLCLCI MACEPVHGPLLISGLGIIALAELLGLVYMKFVASNQRTIQPPRNR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
Gene References into Functions
  1. this study shows that inhibition of IAP represses inflammatory status via nuclear factor-kappa B pathway in murine endometriosis lesions PMID:29105884
  2. Our results support an intrinsic role of CD47 in ovarian cancer progression and immune evasion PMID:28380460
  3. mice deficient in CD47 (CD47 Knockout) had significantly less brain neutrophil infiltration at 24h, upregulated VEGF expression in peri-lesion cortex at 7 and 14day PMID:27931776
  4. TSP1 significantly accelerates replicative senescence and associated cell cycle arrest in a CD47-dependent manner. PMID:27607583
  5. CD47, TSP1, and to a lesser extent SIRPalpha facilitate exosome-mediated myeloid-derived suppressor cells chemotaxis and migration. PMID:27728760
  6. In pulmonary hypertension TSP1-CD47 is upregulated, and contributes to pulmonary arterial vasculopathy and dysfunction. PMID:27742621
  7. thrombospondin-1 via CD47 inhibits renal tubular epithelial cell recovery after ischemia reperfusion injury through inhibition of proliferation/self-renewal. PMID:27259369
  8. these findings have demonstrated how tumor cells inhibit innate sensing in dendritic cells and suggested that the CD47-SIRPalpha axis is critical for dendritic cell-driven antitumor immunity PMID:28801234
  9. this study shows that CD47 deficiency in tumor stroma promotes tumor progression by enhancing angiogenesis PMID:27283989
  10. the results obtained by combining bioinformatics and preclinical studies strongly suggest that targeting TSP-1/CD47 axis may represent a valuable therapeutic alternative for hampering melanoma spreading. PMID:27349907
  11. Treg cells protect dopaminergic neurons against MPP+ neurotoxicity by a cell-to-cell contact mechanism underlying CD47-SIRPA interaction and Rac1/Akt activation. PMID:28268219
  12. CD47 deficient mice with vaccination showed greater protective efficacy against lethal challenge. PMID:27194758
  13. These results indicate an important role for CD47-SIRPalpha interactions in innate control of malaria and suggest novel targets for intervention. PMID:27091932
  14. atherogenesis is associated with upregulation of CD47, a key anti-phagocytic molecule that is known to render malignant cells resistant to programmed cell removal, or 'efferocytosis' PMID:27437576
  15. Erythrocyte CD47 has a key role in hematoma clearance after intracerebral hemorrhage. PMID:26732568
  16. These data indicate that CD47 plays protective roles against disseminated candidiasis and alters pro-inflammatory and immunosuppressive pathways known to regulate innate and T cell immunity. PMID:26010544
  17. CD47 deficiency ameliorates lupus nephritis in Fas(lpr) mice via suppression of IgG autoantibody production. PMID:26095930
  18. the cell adhesion molecule CD47 participates in multiple phases of granule cell development, including proliferation, migration, and neurite differentiation PMID:25288019
  19. CD47 mediates signaling from the extracellular matrix that coordinately regulates basal metabolism and cytoprotective responses to radiation injury PMID:26311851
  20. Taken together, these data revealed a novel role for CD47 in the development of obesity and its related metabolic complications. PMID:25747123
  21. NF KB mediated CD47 up regulation promotes sorafenib resistance treating hepatocellular carcinoma. PMID:25902734
  22. Loss of cell surface CD47 clustering formation and binding avidity to SIRPalpha facilitate apoptotic cell clearance by macrophages. PMID:26085683
  23. findings prove that the TSP-1/CD47/SIRP-alpha signal axis is important to the evolution of tumor cells in the microenvironment of immunotherapy and identify thrombospondin-1 as a key signal PMID:25697354
  24. Thrombospondin-1 and CD47 signaling regulate healing of thermal injury in mice. PMID:24840925
  25. the microglial proinflammatory response to Abeta(1-42) protofibril is not dependent on CD47 PMID:25451248
  26. CD47 expression in the microenvironment was sufficient to limit tumor radiosensitivity. PMID:25297630
  27. role in promoting left ventricular heart failure by CaKMII-mediated up-regulation of HDAC3 PMID:24922625
  28. Polymorphism in the innate immune receptor SIRPalpha controls CD47 binding and autoimmunity in the nonobese diabetic mouse. PMID:25305319
  29. using a syngeneic mouse hepatocyte transplantation model, the present study demonstrates that missing CD47 on donor cells alone can cause recipient myeloid cell activation and graft loss. PMID:23394628
  30. sought to investigate the effect of Hsp70-peptide complex on the expression of CD172alpha and CD47 receptors in normal peritoneal macrophages (NMO) PMID:24684700
  31. CD47 plays the pivotal role in the immune evasion of primary effusion lymphoma cells in body cavities. Therapeutic antibody targeting of CD47 could be an effective therapy for PEL. PMID:24726056
  32. 'clustering' SIRPalpha into plasma membrane microdomains is essential for activated monocytes and macrophages to effectively interact with CD47 and initiate intracellular signaling PMID:24143245
  33. Thrombospondin-1 signaling through CD47 is the first identified endogenous inhibitor of H2S signaling and constitutes a novel mechanism that negatively regulates T cell activation. PMID:23499828
  34. Data indicate that lack of CD47 strongly impairs SIRPalpha-dependent osteoblast differentiation, deteriorate bone formation, and cause reduced formation of osteoclasts. PMID:23990469
  35. Thus, CD47 antagonists enable cell self-renewal and reprogramming by overcoming negative regulation of c-Myc and other stem cell transcription factors. PMID:23591719
  36. CD47 deficiency confers cell survival through the activation of autophagic flux and identifies CD47 blockade as a pharmacological route to modulate autophagy for protecting tissue from radiation injury. PMID:22874555
  37. Inhibitor of apoptosis proteins (IAPs) and their antagonists regulate spontaneous and tumor necrosis factor (TNF)-induced proinflammatory cytokine and chemokine production PMID:23275336
  38. CD47 deficiency promotes nerve fiber growth from cultured ventral mesencephalic dopamine neurons. PMID:23049778
  39. Although polymorphonuclear neutrophil (PMN) transmigration is not delayed in CD47-deficient mice, fewer neutrophils are found in the intestine at the postacute/chronic stage of chronic colitis. PMID:23203922
  40. CD47(low) status on CD4 effectors is necessary for the contraction/resolution of the immune response in humans and mice. PMID:22870271
  41. Thrombospondin-1 regulates blood flow via CD47 receptor-mediated activation of NADPH oxidase 1. PMID:23087362
  42. ectopic expression of murine Cd47 in human hepatocytes selectively favors engraftment upon transplantation into mice, a finding that should have a profound impact on the generation of robust humanized small animal models. PMID:22535707
  43. Activation of parenchymal CD47 promotes renal ischemia-reperfusion injury. PMID:22859854
  44. Engagement of endothelial CD47 by its ligands triggers outside-in signals in endothelium, facilitating leukocyte transendothelial migration at sites of inflammation. PMID:22815286
  45. Data show that CD47(-/-) mice are refractory to experimental autoimmune encephalomyelitis (EAE). PMID:22734047
  46. Activated CD47 promotes pulmonary arterial hypertension through targeting caveolin-1. PMID:22215724
  47. CD47(high) status on CD4 T cells identifies functional long-lived memory T cell progenitors. PMID:22461697
  48. CD47 signalling is dispensable for oral tolerance induction, whereas the expression of CD47 by non-haematopoietic cells is required for intestinal IgA B-cell responses. PMID:22070457
  49. provides a rational basis for targeting CD47-SIRPalpha interactions, using for instance the antagonistic antibodies against human SIRPalpha described herein, to potentiate the clinical effects of cancer therapeutic antibodies PMID:22042861
  50. CD47 deletion improves functional recovery from spinal cord injury via an increase in vascular patency, functional locomotor improvements and greater white matter sparing. PMID:21168495

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Database Links

UNIGENE: Mm.31752

KEGG: mmu:16423

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products