Recombinant Mouse Protein reprimo (Rprm)

Code: CSB-CF878070MO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3310

Quantity:

Express system: in vitro E.coli expression system

Species: Mus musculus (Mouse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Rprm

Uniprot NO.

Q9JJ72

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-109

Target Protein Sequence

MNSVLGNQTDVAGLFLVNSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex.

Gene References into Functions

RPRM is transiently up-regulated at a posttranscriptional level in times of cellular stress to restrict cell survival, proliferation, and tumor formation PMID:22562171
Induction by DNA damage and hypoxia suggest IGFBP-3 plays a role in the physiologic protection against aberrant cell growth. PMID:15769996
Oral administration of green tea or topical caffeine immediately after discontinuation of UVB treatment enhanced the rate and extent of disappearance of the mutant p53-positive patches on skin of hairless mice. PMID:15817611
p53(R273H) binds directly to the relaxin promoter, further confirming a role for H2 relaxin signaling in p53(R273H)-mediated androgen-independent prostate cancer PMID:16434975
targeting p53 to mitochondria does confer a significant growth disadvantage in B-lymphomas expressing various point mutants of p53, resulting in efficient apoptosis induction in vitro and in vivo in mice PMID:16682948
In p53-null cells, this peptide derepresses p73, causing p73-mediated gene activation and death. Moreover, delivery of a transgene expressing this peptide caused tumors. PMID:17347683
tp53 activation occurs at a posttranslational level via chloroquine-dependent phosphorylation of the checkpoint protein {ATM)leading to ATM-dependent phosphorylation of tp53 kinase, and mediating resistance to mammary carcinogenesis. PMID:18089834
Mice deficient in p53 show less degeneration of spermatogenesis was observed in p53-null-jsd mice than jsd single mutants. PMID:18356279