Recombinant Rabbit Integrin beta-8 (ITGB8)

Code: CSB-CF011892RB
Size:
20μg
20μg100μg
US$7927
Quantity:
Express system: in vitro E.coli expression system
Species: Oryctolagus cuniculus (Rabbit)
Tag Info: 10xHis-SUMO-tag
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
ITGB8
Uniprot NO.
Species
Oryctolagus cuniculus (Rabbit)
Source
in vitro E.coli expression system
Expression Region
43-768
Target Protein Sequence
ENSRCASSHAVSCSECLALGPDCGWCVHEDFISGGPRSERCDIVSNLISKGCPVDSIEYPSVHVTIPSENEVNTQVTPGEVSIQLRPGAAANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVESKVPGVYFNVTAICPDGARKLGMEGCSNVTSSDEVLFNVTVTMEKCSVTGGKNYAIIKPIGFNETSKIHIHQNCGCECEASRGGAAKCAEEAPLDSTCPQCQESQCHQEEAQSPSQGCKAHEDQPVCSGRGVCVCGKCLCHKMKLGKVYGKYCEKDDFSCPYHHGSLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECSDPRSIGRFCEHCPTCPTACSENWNCVQCLHPHNLSQAILDQCRTSCASMEQPYVEQASECFSSPSYLRIFFIIFIVTFLIGLLKILIIRQVILQWNSSKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKPEEIKLDISKLNAHETFRCNF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Integrin alpha-V:beta-8 (ITGAV:ITGB8) is a receptor for fibronectin. It recognizes the sequence R-G-D in its ligands. Integrin alpha-V:beta-6 (ITGAV:ITGB6) mediates R-G-D-dependent release of transforming growth factor beta-1 (TGF-beta-1) from regulatory Latency-associated peptide (LAP), thereby playing a key role in TGF-beta-1 activation on the surface of activated regulatory T-cells (Tregs). Required during vasculogenesis.
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Integrin beta chain family
Tissue Specificity
Placenta, kidney, brain, ovary, uterus and in several transformed cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products