Recombinant Rabbit Integrin beta-8 (ITGB8)

Code: CSB-CF011892RB

Rate （N/A）
Review （0）

Size:

20μg100μg

US$7927

Quantity:

Express system: in vitro E.coli expression system

Species: Oryctolagus cuniculus (Rabbit)

Tag Info: 10xHis-SUMO-tag

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

ITGB8

Uniprot NO.

P26013

Species

Oryctolagus cuniculus (Rabbit)

Source

in vitro E.coli expression system

Expression Region

43-768

Target Protein Sequence

ENSRCASSHAVSCSECLALGPDCGWCVHEDFISGGPRSERCDIVSNLISKGCPVDSIEYPSVHVTIPSENEVNTQVTPGEVSIQLRPGAAANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFERAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLRNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVESKVPGVYFNVTAICPDGARKLGMEGCSNVTSSDEVLFNVTVTMEKCSVTGGKNYAIIKPIGFNETSKIHIHQNCGCECEASRGGAAKCAEEAPLDSTCPQCQESQCHQEEAQSPSQGCKAHEDQPVCSGRGVCVCGKCLCHKMKLGKVYGKYCEKDDFSCPYHHGSLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECSDPRSIGRFCEHCPTCPTACSENWNCVQCLHPHNLSQAILDQCRTSCASMEQPYVEQASECFSSPSYLRIFFIIFIVTFLIGLLKILIIRQVILQWNSSKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKPEEIKLDISKLNAHETFRCNF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Integrin alpha-V:beta-8 (ITGAV:ITGB8) is a receptor for fibronectin. It recognizes the sequence R-G-D in its ligands. Integrin alpha-V:beta-6 (ITGAV:ITGB6) mediates R-G-D-dependent release of transforming growth factor beta-1 (TGF-beta-1) from regulatory Latency-associated peptide (LAP), thereby playing a key role in TGF-beta-1 activation on the surface of activated regulatory T-cells (Tregs). Required during vasculogenesis.

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Integrin beta chain family

Tissue Specificity

Placenta, kidney, brain, ovary, uterus and in several transformed cells.

Database Links

UNIGENE: Ocu.1889

KEGG: ocu:100009141

STRING: 9986.ENSOCUP00000001898

Promotions