Recombinant Rabbit Tumor necrosis factor (TNF)

Code: CSB-CF023955RB

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4253

Quantity:

Express system: in vitro E.coli expression system

Species: Oryctolagus cuniculus (Rabbit)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

TNF

Uniprot NO.

P04924

Species

Oryctolagus cuniculus (Rabbit)

Source

in vitro E.coli expression system

Expression Region

1-235

Target Protein Sequence

MSTESMIRDVELAEGPLPKKAGGPQGSKRCLCLSLFSFLLVAGATTLFCLLHFRVIGPQEEEQSPNNLHLVNPVAQMVTLRSASRALSDKPLAHVVANPQVEGQLQWLSQRANALLANGMKLTDNQLVVPADGLYLIYSQVLFSGQGCRSYVLLTHTVSRFAVSYPNKVNLLSAIKSPCHRETPEEAEPMAWYEPIYLGGVFQLEKGDRLSTEVNQPEYLDLAESGQVYFGIIAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Induces insulin resistance in adipocytes via inhibition of insulin-induced IRS1 tyrosine phosphorylation and insulin-induced glucose uptake. Induces GKAP42 protein degradation in adipocytes which is partially responsible for TNF-induced insulin resistance. Plays a role in angiogenesis by inducing VEGF production synergistically with IL1B and IL6.; The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Gene References into Functions

TUNEL staining was positively correlated with TNF-a protein expression. Our findings suggest that apoptosis can be induced in the vocal fold epithelium after 120min of modal intensity phonation. In contrast, shorter durations of vibration exposure do not result in apoptosis signaling. PMID:27577014
Inflammatory factors such as TNF-alpha can stimulate MMP-2/9 activity in corneal epithelium cells. This may be a potential manipulating mechanism of MMP expression in the pathogenesis of corneal diseases. PMID:26125840
The JNK pathway plays an important role in mechanical ventilation-stimulated TNF-alpha expression in alveolar macrophages, but the injury-stimulated IL-8 expression may be regulated by other signaling pathways. PMID:24070709
The TNFalpha-evoked Cl- current. PMID:24084720
IL-1beta and TNF-alpha expression increases significantly during acute lung injury. Ambroxol combined with low-dose heparin inhibits teh release of IL-1beta and TNF-alpha. PMID:21845882
Hypercapnia increased expression of TNFa and decreased expression of NFKB in acute lung injury models. PMID:21158126
In the early stages of myocardial ischemia, bone marrow stem cells are mobilized and home to ischemic myocardium with a concomitant increase in expression of cytokines VEGF and TNFalpha. PMID:20624659
Ammonium perchlorate can increase gene expressions of types I, III collagens, TGF-beta(1) and TNF-alpha in lung of rabbits. PMID:20937628
TNFalpha may either be directly or indirectly involved in vascular damage following an embolic stroke. Moreover, TNFalpha may mediate some of the detrimental effects of tPA on the vascular compartment PMID:17673188

Hide All

Subcellular Location

Cell membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, membrane form]: Membrane; Single-pass type II membrane protein.; [Tumor necrosis factor, soluble form]: Secreted.; [C-domain 1]: Secreted.; [C-domain 2]: Secreted.

Protein Families

Tumor necrosis factor family

Database Links

UNIGENE: Ocu.1971

KEGG: ocu:100009088

STRING: 9986.ENSOCUP00000005787

Promotions