MDRLDANVSSNEGFGSVEKVVLLTFFAMVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV SLAFADLLVSVLVNAFGAIELVQDIWFYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDVIEKRKFNHNSN STFCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRP QTADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEKVWTAFLWL GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPILGQTVPCSTTTINGSTHVLRD TVECGGQWESRCHLTATSPLVAAQPVIRRPQDNDLEDSCSLKRSQS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.
Gene References into Functions
Results indicate that visceral nociceptive transmission through the caudal medulla is negatively modulated by descending serotonin type 4 receptor dependent mechanisms.PMID:28754313
Results support a specific role for 5-HT4-receptors in fine-tuning of the dynamic capacity of hippocampal synapses to express synaptic plasticity.PMID:26800645
Study suggests a novel role for the 5-HT4 receptor in facilitation of dendrite formation in which intracellular signaling of PKA and the BDNF-TrkB system may be involved.PMID:27894797
5-HT4 receptor regulating insulin secretion and acting as a potential drug target in diabetes treatmentPMID:27423314
Increased p11 expression by BDNF and imipramine unraveled a 5-HT4R-mediated modulation of cardiac Ca(2+) handlingPMID:26427584
A novel apical 5-HT4 -mediated bicarbonate secretory pathway and an nitric oxide-dependent inhibitory mechanism are present in the proximal colonPMID:26061462
Results indicate that 5-HT4 receptors are not synthesized by cholinergic cells, and thus would be absent from cholinergic terminals. Several non-cholinergic cell populations in the basal forebrain and its target express these receptors.PMID:25183542
Anhedonia, not despair or a decline in exploratory interest, may be associated with upregulation of Let-7a and downregulation of Htr4 expression in the hippocampus; hippocampal Htr4 level may be regulated by Let-7a in ratsPMID:24582667
We conclude that the 5-HT4(a)-receptor may play a more prominent role in the modulation of motor cortico-ponto-cerebellar, cortico-spinal, rubro-spinal, vestibulo-spinal and cortico-nuclear tracts during juvenile development.PMID:24412663
Activation of 5-HT4 receptors facilitates expression of long-term depression at hippocampal output synapses in acute rat brain slices.PMID:24505387
the 5-HT(4) receptor is a representative of a foetal cardiac gene program, functional in late foetal development and reactivated in heart failure.PMID:23029047
Mucosal 5-HT(4) receptor activation can mediate the prokinetic and antinociceptive actions of 5-HT(4)R agonists.PMID:22226658
beta(1)-AR and 5-HT(4) receptor signalling are subject to opposite regulatory control by cGMP generated by soluble guanylyl cyclase in failing hearts.PMID:21901315
Up-regulation of 5-HT3 and 5-HT4 receptors expression in the mucosal/submucosal layer is involved to restore the delayed transit after the parasympathetic denervation in rats.PMID:20691988
Selective activation of 5-HT(4) receptors improved memory performance in an olfactory associative discrimination task in aged ratsPMID:21745655
Study revealed that 5-HT4b, 5-HT2A and 5-HT2B coexisted in auricular myocytes of newborn rat, that 5-HT4 activation reduced cAMP concentration, ICaL and intercellular coupling whereas 5-HT2A or 5-HT2B activation conversely enhanced GJIC.PMID:19615378
results suggest that 5-HT(4) receptors can modulate GABAergic signalling bidirectionally, depending on the basal PKA activation levels that are determined by neuronal activityPMID:11986365
results report that serotonin 4(a) receptors are strongly expressed in respiratory Pre-Boetzinger complex neurons and that their selective activation protects spontaneous respiratory activityPMID:12855812
5-HT4 receptors located within the cholinergic nucleus basalis magnocellularis may play a role in spatial memoryPMID:14557615
Lysine may be a partial 5-HT4 receptor antagonist and suppresses 5-HT4 receptor-mediated intestinal pathologies and anxiety in ratsPMID:14676321
Construction of benzimidazoles which attach to Htr4 receptor.PMID:14703122
key role for 5-HT4 receptors in the regulation of synaptic plasticity and the determination of the particular properties of stored synaptic informationPMID:15537670
Positive inotropic response of failing heart to 5-HT(4) stimulation results from increased L-type Ca2+ current/sarcoplamic reticulum Ca(2+) content.PMID:17660386
These findings point out 5-HT(4) receptor agonists as a putative class of antidepressants with a rapid onset of action.PMID:17785179
Functional 5-HT(2A) and 5-HT(4) receptors are differentially induced in LV hypertrophy and failure.PMID:17936780
Serotonin 4a receptors were found predominantly in the neuropilat late embryonic (E18-E20) stages. At birth, expression was predominantly somatic.PMID:18076058
complete recovery of associative learning performance in the lesioned rats by 5-HT4 receptor agonistsPMID:18485752
5-HT4 receptor-mediated positive inotropic responses in failing rat ventricle were cAMPdependent.PMID:18846035
In brain, isoform 5-HT4S is restricted to the striatum, but isoform 5-HT4L is expressed throughout the brain, except in the cerebellum. In peripheral tissues, differential expression is also observed in the atrium of the heart where only isoform 5-HT4S is