Recombinant Rat Mitochondrial uncoupling protein 2 (Ucp2)

Code: CSB-CF025555RA
Size:
20μg
20μg100μg
US$4807
Quantity:
Express system: in vitro E.coli expression system
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Ucp2
Uniprot NO.
Species
Rattus norvegicus (Rat)
Source
in vitro E.coli expression system
Expression Region
1-309
Target Protein Sequence
MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLARTAASAQYR GVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTS PNVARNAIVNCTELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYHSAGHCALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA AYESREAPF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
UCP are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation from ATP synthesis. As a result, energy is dissipated in the form of heat.
Gene References into Functions
  1. The present results highlight the neuroprotective actions of UCP2, acting in the inhibition of apoptotic factors and oxidative stress, to increase neuron survival after SE onset. PMID:30159115
  2. These data suggested that atorvastatin significantly attenuated the myocardial remodeling by downregulating the expression of UCP2 that was found to improve the myocardial energy metabolism, inhibit myocardial hypertrophy, and eventually reduce myocardial remodeling. PMID:29559841
  3. Obesity-alleviating potential of asiatic acid and its effects on ACC1, UCP2, and CPT1 mRNA expression in high fat diet-induced obese Sprague-Dawley rats. PMID:28993954
  4. UCP2 inhibits myointimal hyperplasia after vascular injury, probably through suppressing nuclear factor-kappaB-dependent smooth muscle cell proliferation and migration. PMID:29025747
  5. microRNA-503 significantly contributes to mediate brain UCP2 downregulation. PMID:28640254
  6. The findings demonstrated that the UCP2 and NLR family-pyrin domain-containing 3/caspase 1/interleukin 1beta signaling pathway may be involved in intestinal barrier injury and that GIK treatment decreased intestinal barrier permeability. PMID:28428961
  7. GLP-1 likewise increased the synthesis of GR and favored the translocation of the nuclear transcription factor erythroid 2p45-related factor (Nrf2)..Glucose-stimulated insulin secretion was also preserved in beta-cells challenged with tert-BOOH but pre-treated with GLP-1, probably through the down-regulation of the mitochondrial uncoupling-protein2 (UCP2). PMID:26968794
  8. UCP2 has an apoptotic effect in beta cells via regulation of the intrinsic pathway of apoptosis in brain dead organ donors. PMID:28222054
  9. These observations suggest that downregulation of UCP2 expression in the hypothermic preserved rat heart in part initiated the protective mechanism via the SIRT1 pathway. PMID:27356851
  10. study showed that the expression of UCP2 varies according to age and the severity of obesity and supports the widely held notion that increased UCP2 expression is an adaptive response to increased fatty acid beta-oxidation and reactive oxygen species production that occurs during obesity PMID:26621256
  11. In the lungs and the spleen of rats with a chronic alcohol diet cytochrome c release from mitochondria was significantly increased. Both organs did not show any altered gene and protein expression of UCP-2. PMID:26664262
  12. The expression level of UCP2 is closely correlated with mitochondrial injury in sepsis rat model. PMID:26903064
  13. The iPLA2gamma/UCP2 synergy provides a feedback antioxidant mechanism preventing oxidative stress by physiological fatty acid intake in pancreatic beta-cells, regulating glucose-, fatty acid-, and redox-stimulated insulin secretion. PMID:25925080
  14. data demonstrate that mitochondrial morphology and funtion are damaged in cardiomyocytes under septic conditions, while the silencing of UCP2 using siRNA aggravated this process PMID:25873251
  15. propose mitochondrial uncoupling protein-2 manipulation as a potential strategy for redirecting microglial response towards protective phenotypes PMID:26173855
  16. The aim of this study was to investigate the early changes of cardiac uncoupling protein-2 (UCP2) expression following myocardial ischemia reperfusion in rats chronically treated with ramiprilat and losartan. PMID:23372044
  17. Indoxyl sulfate-induced cardiomyocytes hypertrophy was partly due to the inhibition of AMPK/UCP2 signaling and the enhancement of oxidative stress. PMID:25703824
  18. Vitamin D deficiency decreases adiposity in rats and causes altered expression of uncoupling proteins and steroid receptor coactivator3 PMID:25132457
  19. Chronic alcohol consumption leads to a cerebral induction of UCP-2 (and UCP-4). PMID:23800309
  20. miR-30e/UCP2 axis has an important role in mediating TGF-beta1-induced epithelial-mesenchymal transition and kidney fibrosis. PMID:23515048
  21. The expression of SIRT1 is significantly lowered and UCP2 increased in the liver of rats with T2DM and NAFLD. PMID:22588935
  22. Expression of hippocampal UCP2 increases 12 to 48 hours after status epilepticus is induced. PMID:22849356
  23. Resveratrol up-regulates hepatic UCP2 expression and prevents the development of nonalcoholic fatty liver disease in a high-fat diet-treated rodent model. PMID:23084643
  24. UCP2 is a critical protein to prevent oxidative stress damage in renal mesangial cells in vitro. PMID:23297375
  25. Pingtang recipe containing drug-serum shows a protective effect on INS-1 beta pancrentic cells against lipoapoptosis by regulating ROS production and UCP-2 expression. PMID:21179742
  26. blockade of the diabetes-induced upregulation of UCP- 2 results in excessive uncoupling and reduced oxidative stress in the kidney via activation of ANT. PMID:22768304
  27. After vagotomy, ATP contents decreased and UCP2 expression was downregulated in the stomach corpus. PMID:21162199
  28. UCP2 mRNA expression in the hypothyroidism group was significantly lower than that of control group. PMID:21190599
  29. The expression of UCP2 mRNA in the liver failure group was higher as compared to the control group. Expression may be related to levels of SOD, MDA and endotoxin. PMID:21272461
  30. Ucp2 and PPARdelta gene and protein expression increased in rats fed a fructose-rich diet. PMID:21855553
  31. Berberine can down-regulate the expression levels of UCP2 mRNA and UCP2 proteins of hepatic tissue in non-alcoholic fatty liver disease rats. PMID:21359922
  32. UCP2 plays both regulatory and protective roles in beta cells by acutely lowering glucose-stimulated insulin secretion and chronically preventing oxidative stress. PMID:21172424
  33. The frequency of beta cell apoptosis in high-fat feeding rats is affected by oxidative stress, which results in increasing UCP2 gene expression. PMID:20014488
  34. UCP2 expression is rapidly induced via the peroxisome proliferator-activated receptor pathway, thereby increasing cell apoptosis in adult rat cardiomyocytes. PMID:20010438
  35. The expression of UCP2 was upregulated in pressure overload induced failure heart and might be responsible for decreased myocardial adenine nucleotide and energy metabolism disturbance. PMID:20193183
  36. PGC-1alpha is induced by cerebral ischemia leading to upregulation of UCP2 and SOD2, thereby providing a neuroprotective effect against ischemic brain injury in the hippocampus by ameliorating oxidative stress PMID:19774674
  37. induced by long-term cold exposure, promoting decoupling of oxidative phosphorylation PMID:11710805
  38. UCP-2 mRNA is induced by fatty acid oxidation in beta-cells PMID:11897694
  39. energy metabolism and expression of uncoupling protein 2 in brown adipose tissue after 21 days of recovery from intracerebroventricular mouse leptin in rats PMID:12062312
  40. superoxide (or its products) exerts its uncoupling effect by activating the proton transport mechanism of UCP2 at the matrix side of the mitochondrial inner membrane PMID:12372827
  41. The down-regulation of heartUCP2 parallels the lower lipid utilization which may account for an enhanced fat deposition in dietary obese rats PMID:12435081
  42. Thiazolidinediones indirectly stimulate ucp2 transcription by inducing-via PPARgamma-limiting amounts of a protein, which must be phosphorylated by MAPK to stimulate the gene. PMID:12588051
  43. Triiodothyronine selectively enhances transcriptional stimulation of ucp2 by thiazolidinediones and nonselective PPAR ligands by priming the gene to a transactivating signal(s) generated by such ligands. PMID:12588052
  44. Effects of dietary protein content on uncoupling proteins (UCP) 1, 2 and 3 expression in various tissues of Zucker lean and obese rats were studied PMID:12603007
  45. induction of electrogenic ion transport rather than electrophoretic fatty acid activity induced expression of hepatic uncoupling protein 2 (UCP-2) in rats PMID:12756242
  46. data argue against the hypothesis that UCP-2 causes decreased cardiac mechanical efficiency in septic shock PMID:12785014
  47. Data suggest that uncoupling protein-2 is an inducible protein that is neuroprotective by activating cellular redox signaling or by inducing mild mitochondrial uncoupling that prevents the release of apoptogenic proteins. PMID:12858170
  48. Down-regulation of UCP-2 mRNA by IL-1beta is an early event of cytokine interaction with beta-cells which is not directly coupled to cell toxicity. PMID:12967645
  49. UCP2 appears to be regulated by the excitatory stimulus via the cAMP-PKA cascade and serves to negatively control the synaptic output by reducing intracellular ATP levels PMID:14511123
  50. Sympathetic sympathetic tonus generated by exposure of rats to cold induces the expression of PGC-1, which participates in the control of UCP-2 expression in pancreatic islets. PMID:14576981

Show More

Hide All

Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity
Expressed in a variety of organs, with predominant expression in the heart, lung and spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products