Recombinant Rat Smoothened homolog (Smo)

Code: CSB-CF021841RA

Rate （N/A）
Review （0）

Size:

20μg100μg

US$8204

Quantity:

Express system: in vitro E.coli expression system

Species: Rattus norvegicus (Rat)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Smo

Uniprot NO.

P97698

Species

Rattus norvegicus (Rat)

Source

in vitro E.coli expression system

Expression Region

31-793

Target Protein Sequence

RGAALSGNVTGPGPRSAGGSARRNAPVTSPPPPLLSHCGRAAHCEPLRYNVCLGSALPYG ATTTLLAGDSDSQEEAHSKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTL CQATRGPCAIVERERGWPDFLRCTPDHFPEGCPNEVQNIKFNSSGQCEAPLVRTDNPKSW YEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVI LFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRFGEPTSSETLSCVIIFVIVYYALM AGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSV SGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKIN ETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKKPIPD CEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGHSDDEPKRIKKS KMIAKAFSKRRELLQNPGQELSFSMHTVSHDGPVAGLAFELNEPSADVSSAWAQHVTKMV ARRGAILPQDVSVTPVATPVPPEEQANLWLVEAEISPELEKRLGRKKKRRKRKKEVCPLG PAPELHHSAPVPATSAVPRLPQLPRQKCLVAANAWGTGEPCRQGAWTVVSNPFCPEPSPH QDPFLPGASAPRVWAQGRLQGLGSIHSRTNLMEAELLDADSDF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

G protein-coupled receptor that probably associates with the patched protein (PTCH) to transduce the hedgehog's proteins signal. Binding of sonic hedgehog (SHH) to its receptor patched is thought to prevent normal inhibition by patched of smoothened (SMO). Required for the accumulation of KIF7, GLI2 and GLI3 in the cilia. Interacts with DLG5 at the ciliary base to induce the accumulation of KIF7 and GLI2 at the ciliary tip for GLI2 activation.

Gene References into Functions

This study characterizes, for the first time, the transcriptional response of cardiomyocytes to Shh and establishes a critical role for Smo coupling to Gi in Hh signaling in the normal and ischemic myocardium PMID:24816261
The expression of Shh, Smo and Gli1 at the protein and mRNA level in hepatocytes of rats with chronic fluorosis can be increased by fluoride and may be inhibited by cyclopamine. PMID:24388991
Ptch1 and Smo are predominantly localized in the postsynaptic side of the synapses, a distribution pattern similar to that found in hippocampal neurons PMID:22477363
In young rat hippocampal neurons, Smo is present in the processes and growth cones. In mature rat hippocampal neurons, Smo is located predominately in dendrites, dendritic spines, and postsynaptic sites. PMID:21618238
Shh and Smo are upregulated in a time-dependent manner in retinas exposed to ocular hypertension, and Shh has neuroprotective effects on damaged RGCs in a rat chronic hypertension model. PMID:20071678
Facial nerve axotomy upregulates Sonic hedgehog (Shh) and its receptor Smoothened (Smo) in facial motor neurons of adult rats, whereas facial nerve axotomy does not upregulate mRNA of Shh or Smo in neonatal rats. PMID:15356205

Hide All

Subcellular Location

Membrane; Multi-pass membrane protein. Cell projection, cilium.

Protein Families

G-protein coupled receptor Fz/Smo family

Tissue Specificity

In embryo, found in the early neural folds and neural tube, pre-somitic mesoderm and somites, developing limb bud, gut, eye, testes, cartilage, muscle, lung, epiglottis, thymus, tongue, jaw, taste buds, teeth, and skin. In adult, found in multiple tissues

Database Links

UNIGENE: Rn.44429

KEGG: rno:25273

STRING: 10116.ENSRNOP00000011356

Promotions